Welcome to Julies Gift Box
GBP Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Chain Maille Bracelet with Beads - Teal Green and Gold
Chain Maille Bracelet with Beads - Teal Green and Gold
Chain Maille Bracelet with Beads - Teal Green and Gold
Chain Maille Bracelet with Beads - Teal Green and Gold
Chain Maille Bracelet with Beads - Teal Green and Gold

Chain Maille Bracelet with Beads - Teal Green and Gold

Product Code: 6N0VOog
Brand: Julies Gift Box
Product Condition: New
£10.00 inc. tax
 Add to Cart
Description
Chain Maille Bracelet with Beads - Teal Green and Gold


A lovely handmade chain maille bracelet made with gold plated jump rings and silver lined Toho seed beads. Colours go beautifully together.

Ideal for any occasion like birthdays, weddings, anniversaries or just to brighten someones day.

FREE POSTAGE

 

PLEASE NOTE: There is only 1 of this design available.

We can only ship to UK mainland at the moment
Related Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i