Welcome to Julies Gift Box
GBP Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
Bauble Earrings - Iridescent Fuschia Pink Stars
Bauble Earrings - Iridescent Fuschia Pink Stars
Bauble Earrings - Iridescent Fuschia Pink Stars
Bauble Earrings - Iridescent Fuschia Pink Stars
Bauble Earrings - Iridescent Fuschia Pink Stars
Bauble Earrings - Iridescent Fuschia Pink Stars

Bauble Earrings - Iridescent Fuschia Pink Stars

Product Code: miBKGXM
Brand: Julies Gift Box
Product Condition: New
£4.00 inc. tax
 Add to Cart
Description

BAUBLE EARRINGS - Iridescent Fuschia Pink Stars


A stunning handmade pair of bauble earrings with iridescent fuschia pink stars that are loose inside the bauble, with silver plated ear wires.

Perfect for the upcoming Christmas party season.

Fantastic stocking filler.


FREE POSTAGE


PLEASE NOTE: There is only 1 of this design available.

We can only ship to UK mainland at the moment

Updating Order Details
Please do not refresh or navigate away from the page!
Related Products
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i